PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010109556.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family GeBP
Protein Properties Length: 430aa    MW: 47362.2 Da    PI: 4.7016
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010109556.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573122.91.6e-38172266397
          DUF573   3 fqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWg 97 
                     f r+wse+Dei++L+G+ d+kak+g++p++d+ af++f+kks++++vsksqlv+KirrLKkK+ ++ +k +++++p+fsk+h+  +f+lskkiWg
  XP_010109556.1 172 FARVWSEDDEIAVLKGMTDYKAKKGADPYADMGAFHDFIKKSLNADVSKSQLVDKIRRLKKKYLNNAAKGENDEDPVFSKPHELLSFKLSKKIWG 266
                     89********************************************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045045.1E-34172266IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 430 aa     Download sequence    Send to blast
MAPKRLLEKP PPADSSSEDK DESDSAENEE ENGKGNENGA AGADDEEEKS GGDEEVEDES  60
PVKKPTVSKP DDSGSGSDTE SDDTPPSPSL SGFTIKPIVS KPMDDTADKP KKKSSARPNK  120
RATESEDPER ETSEKDSKSK KKRKVTSAAA SASVTASNGG GDEEDSKKSS GFARVWSEDD  180
EIAVLKGMTD YKAKKGADPY ADMGAFHDFI KKSLNADVSK SQLVDKIRRL KKKYLNNAAK  240
GENDEDPVFS KPHELLSFKL SKKIWGIGAK KSPNGNNVED SDLKSRSSKK TPVPSTPVSK  300
STTTVLALPS KEMSVKKEKK KREQVEANGK VRVEKEGEDE DEDEEEEEED EEGGEEEEFW  360
DKYPHLNKSL ESCFSSEFKI CLPLVETSKL EKLDKKWREL QIEELGLFVR KAHLSQEQAE  420
LVLGVLKRSV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1139144KKKRKV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010109556.10.0hypothetical protein L484_018291
TrEMBLW9SAQ10.0W9SAQ1_9R
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF139661119
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61730.11e-29DNA-binding storekeeper protein-related transcriptional regulator